Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

trifluoroacetate salt
trifluoroacetate salt

4033157

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4033157.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 840.00
CHF 781.20 (7%)
4033157.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,576.00
CHF 1,465.68 (7%)
Add to Wish List
Add to Compare

Details

This member of the galanin family has been isolated from porcine hypothalamus. It is a 60 amino acid peptide that, unlike galanin, has a non-amidated C-terminus. GALP amino acid residues (9-21) are identical to the biologically active N-terminal (1-13) portion of galanin. Receptor binding studies revealed that GALP had a high affinity for the galanin receptor 2 (GALR2; IC₅₀ = 0.24 nM) and a lower affinity for the GALR1 receptor (IC₅₀ = 4.3 nM). GALP is therefore an endogenous ligand that preferentially binds the GALR2 receptor, whereas galanin is relatively non-selective.
Catalog Number H-4982
One Letter Code APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS
Synonyms GALP (porcine)
Molecular Formula C₂₈₁H₄₄₃N₈₁O₇₈
Relative Molecular Mass 6204.11
CAS Registry Number [245114-96-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C