Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Apelin-36 (human)
H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH

4034005

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034005.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4034005.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 683.00
CHF 635.19 (7%)
Add to Wish List
Add to Compare

Details

The orphan G protein-coupled receptor APJ has been shown to be a coreceptor for human and simian immunodeficiency virus (HIV and SIV) strains. As long as apelin is an endogenous ligand for the APJ receptor, inhibitory effects of apelin peptides on HIV infection have been examined and it has been found that the apelin peptides inhibit the entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. For apelin-36 the strongest inhibitory efficiency has been reported.
Catalog Number H-4896
APC Number 12-1-21
One Letter Code LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Molecular Formula C₁₈₄H₂₉₇N₆₉O₄₃S
Relative Molecular Mass 4195.89
CAS Registry Number [252642-12-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Infectious Disease
Virology