Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Ser⁸)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

4029130

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4029130.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4029130.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

The replacement of alanine by serine significantly improved the plasma stability of GLP-1 (7-36) amide against DPP IV without impairing its insulinotropic activity. This may indicate that this modification could improve the potential of GLP-1 in the treatment of type-II diabetes.
Catalog Number H-4592
APC Number 46-1-05
One Letter Code HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms (Ser⁸)-Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat), (Ser⁷⁹)-Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat), (Ser⁹⁹)-Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat)
Molecular Formula C₁₄₉H₂₂₆N₄₀O₄₆
Relative Molecular Mass 3313.68
CAS Registry Number [215777-46-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes