Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

CART (55-102) (human) trifluoroacetate salt
H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH trifluoroacetate salt
(Disulfide bonds between Cys⁶⁸ and Cys⁸⁶/Cys⁷⁴ and Cys⁹⁴/Cys⁸⁸ and Cys¹⁰¹)

4030508

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030508.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4030508.0500 0.5 mg Ships within 3-5 business days  
CHF 1,261.00
CHF 1,172.73 (7%)
4030508.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,891.00
CHF 1,758.63 (7%)
Add to Wish List
Add to Compare

Details

CART peptides, especially CART (55-102) appear to have an important function in the regulation of energy homeostasis. Intracerebroventricular administration of CART (55-102) reduces appetite and stimulates energy expenditure, whereas injection of the peptide into specific hypothalamic nuclei increases food intake.
Catalog Number H-4444
APC Number 46-2-56
One Letter Code VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Molecular Formula C₂₂₅H₃₆₅N₆₅O₆₅S₇
Relative Molecular Mass 5245.23
CAS Registry Number [214050-22-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Regulator of energy homeostasis
Areas of Interest Obesity Research