Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) trifluoroacetate salt
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

4027697

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4027697.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 399.00
CHF 371.07 (7%)
4027697.0005 5 mg Ships within 3-5 business days  
CHF 1,576.00
CHF 1,465.68 (7%)
Add to Wish List
Add to Compare

Details

Glucagon-like peptide-1 (GLP-1) is efficiently degraded by the enzyme dipeptidyl peptidase IV (DPP IV), yielding the major metabolite GLP-1 (9-36) amide. GLP-1 (9-36) amide does not affect glucose disposal in mice either in the presence or absence of intact GLP-1 receptors or in the presence or absence of stimulated insulin levels. This suggests that the GLP-1 metabolite is not involved in the regulation of glucose homeostasis. Elahi et al. have shown that this GLP-1 metabolite acts as a weak insulinotropic agent and inhibits hepatic glucose production.
Catalog Number H-4012
One Letter Code EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms Glucagon-Like Peptide 1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat), Preproglucagon (100-127) amide (human, bovine, guinea pig, mouse, porcine, rat), Proglucagon (80-107) amide (human, bovine, guinea pig, mouse, porcine, rat)
Molecular Formula C₁₄₀H₂₁₄N₃₆O₄₃
Relative Molecular Mass 3089.46
CAS Registry Number [161748-29-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Major metabolite of GLP-1
Areas of Interest Diabetes