Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Ile⁵,Trp²³,Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt
H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH trifluoroacetate salt

4031192

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4031192.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 399.00
CHF 371.07 (7%)
4031192.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 714.00
CHF 664.02 (7%)
Add to Wish List
Add to Compare
Catalog Number H-3924
One Letter Code AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
Synonyms (Ile⁵,Trp²³,Tyr³⁶)-pTHrP (1-36) (human, mouse, rat), (Ile⁵,Trp²³,Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Molecular Formula C₁₉₆H₃₀₈N₅₈O₅₃
Relative Molecular Mass 4324.96
CAS Registry Number [181057-31-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C