Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRF (human) acetate salt
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ acetate salt

4011472

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4011472.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4011472.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,261.00
CHF 1,172.73 (7%)
Add to Wish List
Add to Compare

Details

GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.
Catalog Number H-3695
APC Number 52-1-50
One Letter Code YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
Synonyms Somatorelin, Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRH (human), Somatoliberin (human), Somatocrinin (human), GHRF (1-44), human
Molecular Formula C₂₁₅H₃₅₈N₇₂O₆₆S
Relative Molecular Mass 5039.72
CAS Registry Number [83930-13-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C