Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH (18-48) (human)
H-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-OH

4026668

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4026668.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 704.00
CHF 654.72 (7%)
4026668.1000 1 mg Ships within 3-5 business days  
CHF 1,261.00
CHF 1,172.73 (7%)
Add to Wish List
Add to Compare

Details

In bone-derived assay systems this pTH fragment retains the ability to induce cell proliferation and exhibits partial agonist activity in the adenylyl cyclase/protein kinase A signal transduction pathway. It is the most N-terminally truncated pTH fragment having such characteristics.
Catalog Number H-3412
One Letter Code MERVEWLRKKLQDVHNFVALGAPLAPRDAGS
Molecular Formula C₁₅₆H₂₅₁N₄₇O₄₃S
Relative Molecular Mass 3505.07
CAS Registry Number [153238-99-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Osteoporosis Research