Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

trifluoroacetate salt
trifluoroacetate salt
(Disulfide bond)

4030456

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030456.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
4030456.1000 1 mg Ships within 3-5 business days  
CHF 368.00
CHF 342.24 (7%)
Add to Wish List
Add to Compare
Catalog Number H-3354
APC Number 22-1-17
One Letter Code YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH₂
Synonyms Tyr-CGRP I (human), [Tyr0] Calcitonin Gene Related Peptide, human
Molecular Formula C₁₇₂H₂₇₆N₅₂O₅₁S₂
Relative Molecular Mass 3952.54
CAS Registry Number [124756-98-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C