Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Neuropeptide Y (3-36) (human, rat) trifluoroacetate salt
H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

4031095

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4031095.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4031095.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
Add to Wish List
Add to Compare

Details

Main degradation product of NPY in serum and Y2/Y5 receptor agonist.
Catalog Number H-3326
APC Number 60-1-17
One Letter Code SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
Molecular Formula C₁₇₅H₂₆₉N₅₃O₅₄S
Relative Molecular Mass 4011.45
CAS Registry Number [150138-78-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Obesity Research