Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat)
H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH

4031193

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4031193.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
4031193.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 851.00
CHF 791.43 (7%)
Add to Wish List
Add to Compare

Details

(Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.
Catalog Number H-3208
One Letter Code AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Synonyms (Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Molecular Formula C₁₉₄H₃₀₃N₅₉O₅₃
Relative Molecular Mass 4309.91
CAS Registry Number [213779-11-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Osteoporosis Research