Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock



4030477

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030477.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
4030477.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
Add to Wish List
Add to Compare

Details

Cecropin B is a 35-residue peptide which showed activity against different tumor cell lines.
Catalog Number H-3096
One Letter Code KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH₂
Molecular Formula C₁₇₆H₃₀₂N₅₂O₄₁S
Relative Molecular Mass 3834.73
CAS Registry Number [80451-05-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antitumor peptide

Bachem product citations

M.Bacalum and M.Radu, Int. J. Peptide Res. Ther., 21, 47 (2015)