Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH trifluoroacetate salt
(Disulfide bond)

4030382

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030382.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
4030382.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 410.00
CHF 381.30 (7%)
Add to Wish List
Add to Compare

Details

Urodilatin, a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation.
The use of H-3046 is protected by patents. It is sold by Bachem for research purposes only, by expressed permission of Pharis Biotec GmbH, Hannover, Germany (www.pharis-biotec.com).
Catalog Number H-3046
APC Number 14-1-15
One Letter Code TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Synonyms Urodilatin, Ularitide, Urodilatin (95-126)
Molecular Formula C₁₄₅H₂₃₄N₅₂O₄₄S₃
Relative Molecular Mass 3505.98
CAS Registry Number [115966-23-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Atrial natriuretic peptide detected in urine