Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Tyr-Proinsulin C-Peptide (55-89) (human)
H-Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg-OH

4015509

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4015509.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)
4015509.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 946.00
CHF 879.78 (7%)
Add to Wish List
Add to Compare
Catalog Number H-2465
One Letter Code YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR
Molecular Formula C₁₆₂H₂₆₈N₅₀O₅₄
Relative Molecular Mass 3780.21
CAS Registry Number [139532-11-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes