Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock



4031269

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4031269.0010 10 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 115.00
CHF 106.95 (7%)
4031269.0050 50 µg Ships within 3-5 business days  
CHF 305.00
CHF 283.65 (7%)
Add to Wish List
Add to Compare

Details

Human apo-SAA is a 104-amino acid polypeptide which is synthesized in the liver and circulates primarily in association with high-density lipoproteins (HDLs). Under conditions of inflammatory stimulus, the level of apo-SAA increases as much as 1000-fold within a 24-hour period, making it the most abundant HDL. Although the physiological role of apo-SAA remains largely unknown, it appears to play a significant role in inflammation and in certain coronary diseases.
Catalog Number H-1724
One Letter Code MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Synonyms rec apo-SAA (human)
Molecular Formula C₅₂₂H₇₅₉N₁₅₅O₁₅₇S₃
Relative Molecular Mass 11813.92
CAS Registry Number [1927910-97-1]
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein