Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRP (porcine)

4011672

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4011672.0500 0.5 mg Ships within 3-5 business days  
CHF 210.00
CHF 195.30 (7%)
4011672.1000 1 mg Ships within 3-5 business days  
CHF 368.00
CHF 342.24 (7%)
Add to Wish List
Add to Compare
Catalog Number H-1635
APC Number 46-4-40
One Letter Code APVSVGGGTVLAKMYPRGNHWAVGHLM-NH₂
Synonyms Gastrin Releasing Peptide, porcine
Molecular Formula C₁₂₆H₁₉₈N₃₈O₃₁S₂
Relative Molecular Mass 2805.33
CAS Registry Number [74815-57-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research