Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Pancreatic Polypeptide (human) trifluoroacetate salt
H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH₂ trifluoroacetate salt

4015101

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4015101.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4015101.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

As antagonist of CCK, PP inhibits pancreatic sedretion. PP also acts on the gastrointestinal motility, food intake, and metabolism.
Catalog Number H-1610
APC Number 46-1-69
One Letter Code APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH₂
Molecular Formula C₁₈₅H₂₈₇N₅₃O₅₄S₂
Relative Molecular Mass 4181.77
CAS Registry Number [75976-10-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C