Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

ω-Agatoxin IVa trifluoroacetate salt
H-Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH trifluoroacetate salt
(Disulfide bonds between Cys⁴ and Cys²⁰/Cys¹² and Cys²⁵/Cys¹⁹ and Cys³⁶/Cys²⁷ and Cys³⁴)

4030173

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030173.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4030173.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 2,206.00
CHF 2,051.58 (7%)
Add to Wish List
Add to Compare

Details

ω-Agatoxin IVa is a peptide isolated from the venom of the American funnel web spider, Agelenopsis aperta. ω-Aga IVa is a selective and potent blocker of the mammalian P-type voltage-dependent calcium channel.
Catalog Number H-1544
APC Number 41-0-68
One Letter Code KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Molecular Formula C₂₁₇H₃₆₀N₆₈O₆₀S₁₀
Relative Molecular Mass 5202.33
CAS Registry Number [145017-83-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Ion Channel Modulating Agents