Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) trifluoroacetate salt

4014442

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4014442.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 92.00
CHF 85.56 (7%)
4014442.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 241.00
CHF 224.13 (7%)
4014442.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 403.00
CHF 374.79 (7%)
4014442.5000 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,321.00
CHF 1,228.53 (7%)
Add to Wish List
Add to Compare

Details

Amyloid β-peptide (1-40) showed both neurotrophic and neurotoxic effects in dependence on the neuronal age and the concentration of the β-protein. Aβ 1-40 has been used as well as Aβ 1-42 to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients. The sequence of H-1194 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ40 peptide. Besides the TFA salt, Bachem offers the HCl salt of the peptide (H-5568). H-2972, the inverted sequence, can be used as inactive control in experiments employing Aβ 1-40.
For detailed descriptions of the preparation of wild-type and mutant Aβ 1-40 monomers and protofibrils please see the paper of Jan, Hartley, and Lashuel.
Catalog Number H-1194
APC Number 62-0-78
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 trifluoroacetate salt, β-Amyloid (1-40)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [131438-79-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease

Bachem product citations

A.Accardo et al., Vib. Spectrosc., 80, 30 (2015)
R.Videira et al., Flavour Fragr. J., 28, (2013)
Y.Miura and H.Mizuno, Bull. Chem. Soc. Jpn., 83, 1004 (2010)