Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt

4031084

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4031084.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4031084.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 630.00
CHF 585.90 (7%)
Add to Wish List
Add to Compare

Details

PACAP-38 and its N-terminal fragment PACAP-27 are neuropeptides originally isolated from ovine hypothalamus, but also found in humans and rats. Both PACAP-27, which shows considerable homology with vasoactive intestinal polypeptide (VIP), and PACAP-38 stimulate adenylate cyclase much more potently than VIP. Specific PACAP receptors have been identified in different tissues and cell lines.Kojro et al. observed that the PAC1 agonists PACAP-27 and PACAP-38 strongly increased the activity of α-secretase, thus promoting the non-amyloidogenic processing of amyloid precursor protein.
Catalog Number H-1172
APC Number 34-0-40
One Letter Code HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
Molecular Formula C₁₄₂H₂₂₄N₄₀O₃₉S
Relative Molecular Mass 3147.65
CAS Registry Number [127317-03-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C