Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

ACTH (1-39) (human) trifluoroacetate salt
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

4030325

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030325.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 189.00
CHF 175.77 (7%)
4030325.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
Add to Wish List
Add to Compare

Details

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Catalog Number H-1160
APC Number 10-1-10
One Letter Code SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Synonyms Corticotropin
Molecular Formula C₂₀₇H₃₀₈N₅₆O₅₈S
Relative Molecular Mass 4541.13
CAS Registry Number [12279-41-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone