×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
4059088

Availability: In stock

Preptin (human) trifluoroacetate salt
H-Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH trifluoroacetate salt

4059088

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4059088.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)

Details

Preptin is a 34-amino acid peptide hormone, corresponding to Asp⁶⁹-Leu¹⁰² of the proinsulin-like growth factor II E-peptide. It is co-secreted with insulin and amylin from the pancreatic β-cells and is a physiological amplifier of glucose-mediated insulin secretion. It is also anabolic to bone tissue and may contribute to the preservation of bone mass observed in hyperinsulinemic states such as obesity.
Catalog Number H-6568
APC Number 50-1-41
One Letter Code DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Molecular Formula C₁₈₇H₂₇₅N₄₇O₅₃
Relative Molecular Mass 4029.53
CAS Registry Number 315197-69-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Obesity Research
Regenerative Medicine
Links / Documents:

Product citations

G.Yang et al., Ann. Med., 41, 52 (2009)
J.Cornish et al., Am. J. Physiol. Endocrinol. Metab., 292, E117 (2007)
C.M.Buchanan et al., Biochem. J., 360, 431 (2001)