Kisspeptin-54 (human) 4054937 | Bachem https://shop.bachem.com/4054937.html

Return to Previous Page

Availability: In stock

Kisspeptin-54 (human) trifluoroacetate salt
H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ trifluoroacetate salt

4054937

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4054937.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 630.00	CHF 585.90 (7%)
4054937.1000	1 mg	Ships within 3-5 business days		CHF 1,156.00	CHF 1,075.08 (7%)

Details

Kisspeptin-54, an endogenous ligand of the G protein-coupled receptor GPR54, is a key regulator of the hypothalamo-pituitary-gonadal (HPG) axis. It stimulates LH and FSH secretion. Kisspeptin-54 may represent a versatile tool for the manipulation of the HPG axis.

Catalog Number H-6514

One Letter Code GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂

Synonyms Malignant Melanoma Metastasis-Suppressor KiSS-1 (68-121) (human), Metastin (human), KiSS-1 (68-121) (human)

Molecular Formula C₂₅₈H₄₀₁N₇₉O₇₈

Relative Molecular Mass 5857.51

CAS Registry Number 374683-24-6

Source Synthetic

Storage Conditions -20 ± 5 °C

Application Cancer Research
Pituitary & Hypothalamic Hormones

Links / Documents: