×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!
4033441

Availability: In stock

Biotinyl-ACTH (1-39) (human) trifluoroacetate salt
Biotinyl-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

4033441

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4033441.0500 0.5 mg Ships within 3-5 business days  
CHF 102.00
CHF 94.86 (7%)
4033441.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 189.00
CHF 175.77 (7%)

Details

ACTH (1–39) is a member of the melanocortin receptor agonists, which stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol.
Catalog Number H-7676
APC Number 10-1-11
One Letter Code Biotinyl- SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Synonyms Biotin-ACTH (1-39), Human
Molecular Formula C₂₁₇H₃₂₂N₅₈O₆₀S₂
Relative Molecular Mass 4767.43
CAS Registry Number 1816258-26-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biotin
Application Biotinylated Peptides
Pituitary & Hypothalamic Hormones
Links / Documents:
Brochures:
Related products