×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4107743
Return to Previous Page
New!
4107743

Availability: In stock

Amyloid β-Protein (42-1) (HFIP-treated)
H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH (HFIP-treated)

4107743

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4107743.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 122.00
CHF 113.46 (7%)
4107743.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 403.00
CHF 374.79 (7%)

Details

Reverse sequence of Aβ42, inactive control for the Aβ. Treating Aβ-peptides with 1,1,1,3,3,3-hexafluoroisopropanol (HFIP) is the standard method for disrupting amyloid fibrils and generating the Aβ monomers. Working with HFIP-treated Aβ-peptides has the advantage of getting more reproducible results whereas untreated Aβ-peptides may contain varying amounts and types of oligomeric structures.
Catalog Number H-8388
One Letter Code AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number 317366-82-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:
Related products