Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Promobanner OCT 2020

New!

Availability: In stock

(Thr²)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Thr-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4104329

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4104329.2001 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 275.00
CHF 255.75 (7%)
4104329.2002 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 470.00
CHF 437.10 (7%)

Details

A mutation very close to the β-secretase cleavage site of APP. The Icelandic mutation A2T of Aβ42 turned out to be less pathogenic than the native sequence. The precursor APP A673T was the first APP variant discovered in humans reducing the risk of Alzheimer's disease. A2T as well affects γ-secretase cleavage, the mutant was an inefficient substrate in a cell-based assay of the enzyme.
Catalog Number H-8292
One Letter Code DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) lcelandic mutation
Molecular Formula C₂₀₄H₃₁₃N₅₅O₆₁S
Relative Molecular Mass 4544.13
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease