Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tide Fluor™ 2-LL-37 (scrambled) trifluoroacetate salt
Tide Fluor™ 2-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

4104171

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4104171.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 245.00
CHF 227.85 (7%)
4104171.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 857.00
CHF 797.01 (7%)
Add to Wish List
Add to Compare

Details

Dye-labeled, scrambled sequence of LL-37, excitation 500nm, emission 527nm. Tide Fluor™-2 shows an excellent photostability and brightness, its fluorescence is pH-insensitive. "Scrambled" means that it contains the same amino acids as LL-37, but in different order.
Catalog Number H-8288
One Letter Code Tide Fluor™-2-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃ + dye
Relative Molecular Mass 4962
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Dye-labeled LL37