×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4099712
Return to Previous Page
New!
4099712

Availability: In stock

Tyr-LL-37 trifluoroacetate salt
H-Tyr-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

4099712

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4099712.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
4099712.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 260.00
CHF 241.80 (7%)

Details

LL-37 analog for radioiodination.
Catalog Number H-7902
One Letter Code YLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Synonyms Tyr- hCAP-18 (134-170), [Tyr133]- Cationic Antimicrobial Protein 18 (134-170) (human)
Molecular Formula C₂₁₄H₃₄₉N₆₁O₅₅
Relative Molecular Mass 4656.50
CAS Registry Number 2022972-74-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures: