Tyr-LL-37 4099712 | Bachem https://shop.bachem.com/4099712.html

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

Tyr-LL-37 trifluoroacetate salt
H-Tyr-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4099712.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 153.00	CHF 142.29 (7%)
4099712.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 260.00	CHF 241.80 (7%)

LL-37 analog for radioiodination.

Catalog Number H-7902

One Letter Code YLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Synonyms Tyr- hCAP-18 (134-170), [Tyr133]- Cationic Antimicrobial Protein 18 (134-170) (human)

Molecular Formula C₂₁₄H₃₄₉N₆₁O₅₅

Relative Molecular Mass 4656.50

CAS Registry Number 2022972-74-1

Source Synthetic

Storage Conditions -20 ± 5 °C

Application Antimicrobial & Antiviral Peptides

Links / Documents:

Brochures: