Biotinyl-εAhx-LL-37 (scrambled) 4099709

Return to Previous Page

New!

Availability: In stock

Biotinyl-εAhx-LL-37 (scrambled) trifluoroacetate salt
Biotinyl-εAhx-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4099709.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 367.00	CHF 341.31 (7%)
4099709.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 622.00	CHF 578.46 (7%)

Add to Wish List

Add to Compare

Biotin-LC-LL 37 (scrambled).

Catalog Number H-7896

One Letter Code Biotinyl-εAhx-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Synonyms Biotinyl-LC-Cationic Antimicrobial Protein 18 (134-170) (human) (Scrambled), Biotinyl-LC-hCAP-18 (134-170) (Scrambled)

Molecular Formula C₂₂₁H₃₆₅N₆₃O₅₆S

Relative Molecular Mass 4832.79

CAS Registry Number [2022972-72-9] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Antimicrobial & Antiviral Peptides
Biotinylated Peptides

Links / Documents:

Brochures: