×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4099709
Return to Previous Page
New!
4099709

Availability: In stock

Biotinyl-εAhx-LL-37 (scrambled) trifluoroacetate salt
Biotinyl-εAhx-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

4099709

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4099709.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 367.00
CHF 341.31 (7%)
4099709.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 622.00
CHF 578.46 (7%)

Details

Biotin-LC-LL 37 (scrambled).
Catalog Number H-7896
One Letter Code Biotinyl-εAhx-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms Biotinyl-LC-hCAP-18 (134-170) (Scrambled), Biotinyl-LC-Cationic Antimicrobial Protein 18 (134-170) (human) (Scrambled)
Molecular Formula C₂₂₁H₃₆₅N₆₃O₅₆S
Relative Molecular Mass 4832.79
CAS Registry Number 2022972-72-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Antimicrobial & Antiviral Peptides
Biotinylated Peptides
Links / Documents:
Brochures: