(Asp³⁷)-Amyloid β-Protein (1-42) 4099631

Return to Previous Page

New!

Availability: In stock

(Asp³⁷)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Asp-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4099631.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 301.00	CHF 279.93 (7%)
4099631.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 505.00	CHF 469.65 (7%)

Add to Wish List

Add to Compare

The G37D mutant does not show the aggregation behavior of WT Abeta42 nor its neurotoxicity.

Catalog Number H-7842

One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVDGVVIA

Synonyms [Asp37] - beta - Amyloid (1 - 42), [Asp37]-Abeta (1-42), Human, Amyloid-beta Peptide(1-42), G37D, Human

Molecular Formula C₂₀₅H₃₁₃N₅₅O₆₂S

Relative Molecular Mass 4572.14

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Alzheimer's Disease

Links / Documents:

Brochures: