×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4099631
Return to Previous Page
New!
4099631

Availability: In stock

(Asp³⁷)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Asp-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4099631

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4099631.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 301.00
CHF 279.93 (7%)
4099631.1000 1 mg Ships within 3-5 business days  
CHF 505.00
CHF 469.65 (7%)

Details

The G37D mutant does not show the aggregation behavior of WT Abeta42 nor its neurotoxicity.
Catalog Number H-7842
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVDGVVIA
Synonyms [Asp37]-Abeta (1-42), Human, [Asp37] - beta - Amyloid (1 - 42), Amyloid-beta Peptide(1-42), G37D, Human
Molecular Formula C₂₀₅H₃₁₃N₅₅O₆₂S
Relative Molecular Mass 4572.14
CAS Registry Number 1875128-79-2
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

J.Kanski et al., Neurotox. Res., 4, 219 (2002)