×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4099397
Return to Previous Page
New!
4099397

Availability: In stock

Tau Peptide (244-274) (Repeat 1 Domain) trifluoroacetate salt
H-Gln-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH trifluoroacetate salt

4099397

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4099397.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 71.00
CHF 66.03 (7%)
4099397.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 122.00
CHF 113.46 (7%)

Details

During heparin-induced self-aggregation of the four repeat domain peptides (R1–R4) excised from tau, R1, which resembles Tau Peptide (244-274), was the most resistive to filament formation. Its conformation remained unchanged. The peptide maintained the same random structure under both acidic and neutral conditions.
Catalog Number H-7982
One Letter Code QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Molecular Formula C₁₄₁H₂₃₈N₄₂O₄₄S
Relative Molecular Mass 3257.63
CAS Registry Number 330456-24-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Tau Peptides
Links / Documents:
Brochures:

Product citations

F.Mizushima, J. Biochem., 142, 49 (2007)