×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4099396
Return to Previous Page
New!
4099396

Availability: In stock

Tau Peptide (245-274) (Repeat 1 Domain) trifluoroacetate salt
H-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH trifluoroacetate salt

4099396

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4099396.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 102.00
CHF 94.86 (7%)
4099396.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 173.00
CHF 160.89 (7%)

Details

Sequence adjacent to the aggregating PHF6* motif (VQIINK). In PHF-tau, N-methylation of Lys²⁵⁴ and Lys²⁶⁷ and phosphorylation of Ser²⁶² was detected. If not methylated, Lys²⁵⁴ is an ubiquitinylation site.
Catalog Number H-7978
One Letter Code TAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Molecular Formula C₁₃₆H₂₃₀N₄₀O₄₂S
Relative Molecular Mass 3129.63
CAS Registry Number 1428134-39-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Tau Peptides
Links / Documents:
Brochures:

Product citations

S.N.Thomas et al., Acta Neuropathol., 123, 105 (2012)