BNP-32 (human) 4095916

Return to Previous Page

Availability: In stock

BNP-32 (human) hydrochloride salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH hydrochloride salt
(Disulfide bond)

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4095916.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 122.00	CHF 113.46 (7%)
4095916.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 209.00	CHF 194.37 (7%)

Catalog Number H-7774

APC Number 14-1-90

One Letter Code SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Synonyms Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human

Molecular Formula C₁₄₃H₂₄₄N₅₀O₄₂S₄

Relative Molecular Mass 3464.09

CAS Registry Number [124584-08-3] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Biomarker for cardiac diseases; Lipolysis-inducing peptide

Areas of Interest Cardiovascular System & Diseases
Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.