×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095913
Return to Previous Page
New!
4095913

Availability: In stock

C-Type Natriuretic Peptide (1-53) (human) acetate salt
H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH acetate salt (Disulfide bond)

4095913

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095913.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 230.00
CHF 213.90 (7%)
4095913.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 403.00
CHF 374.79 (7%)
Catalog Number H-7766
APC Number 14-1-42
One Letter Code DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Synonyms C-Type Natriuretic Peptide (1-53), human, CNP-53 (human)
Molecular Formula C₂₅₁H₄₁₇N₈₁O₇₁S₃
Relative Molecular Mass 5801.77
CAS Registry Number 141294-77-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cardiovascular System & Diseases
Regenerative Medicine
Links / Documents:

Product citations

N.Minamino et al., Biochem. Biophys. Res. Commun., 179, 535 (1991)
Related products