C-Type Natriuretic Peptide (1-53) (human) 4095913

Return to Previous Page

Availability: In stock

C-Type Natriuretic Peptide (1-53) (human) acetate salt
H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH acetate salt
(Disulfide bond)

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4095913.0500	0.5 mg	Ships within 3-5 business days		CHF 230.00	CHF 213.90 (7%)
4095913.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 403.00	CHF 374.79 (7%)

Catalog Number H-7766

APC Number 14-1-42

One Letter Code DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Synonyms CNP-53 (human), C-Type Natriuretic Peptide (1-53), human

Molecular Formula C₂₅₁H₄₁₇N₈₁O₇₁S₃

Relative Molecular Mass 5801.77

CAS Registry Number [141294-77-1] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Cardiovascular System & Diseases
Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.