Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Galanin (human) acetate salt
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH acetate salt

4095896

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4095896.0500 0.5 mg Ships within 3-5 business days  
CHF 102.00
CHF 94.86 (7%)
4095896.1000 1 mg Ships within 3-5 business days  
CHF 179.00
CHF 166.47 (7%)
Add to Wish List
Add to Compare

Details

Galanin has been shown to inhibit acetylcholine release, glutamate release and carbachol-stimulated phosphatidylinositol hydrolysis in the hippocampus. The peptide hormone is also linked to behavioral and cognitive deficits in Alzheimer's disease.
Catalog Number H-7762
APC Number 46-1-01
One Letter Code GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Synonyms Galanin, human
Molecular Formula C₁₃₉H₂₁₀N₄₂O₄₃
Relative Molecular Mass 3157.45
CAS Registry Number [119418-04-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease