×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095896
Return to Previous Page
New!
4095896

Availability: In stock

Galanin (human) acetate salt
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH acetate salt

4095896

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095896.0500 0.5 mg Ships within 3-5 business days  
CHF 102.00
CHF 94.86 (7%)
4095896.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 179.00
CHF 166.47 (7%)

Details

Galanin has been shown to inhibit acetylcholine release, glutamate release and carbachol-stimulated phosphatidylinositol hydrolysis in the hippocampus. The peptide hormone is also linked to behavioral and cognitive deficits in Alzheimer's disease.
Catalog Number H-7762
APC Number 46-1-01
One Letter Code GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Synonyms Galanin, human
Molecular Formula C₁₃₉H₂₁₀N₄₂O₄₃
Relative Molecular Mass 3157.45
CAS Registry Number 119418-04-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:

Product citations

W.E.Schmidt et al., Proc. Natl. Acad. Sci. USA, 88, 11435 (1991)
Related products