×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095874
Return to Previous Page
New!
4095874

Availability: In stock

GLP-2 (1-33) (human) ammonium acetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH ammonium acetate salt

4095874

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095874.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 102.00
CHF 94.86 (7%)
4095874.1000 1 mg Ships within 3-5 business days  
CHF 179.00
CHF 166.47 (7%)
Catalog Number H-7742
APC Number 46-0-80
One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Synonyms Preproglucagon (146-178) (human), GLP-2, human, Glucagon-Like Peptide 2 (human), Proglucagon (126-158) (human)
Molecular Formula C₁₆₅H₂₅₄N₄₄O₅₅S
Relative Molecular Mass 3766.16
CAS Registry Number 223460-79-5
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:
Brochures:
Related products