GLP-2 (1-33) (human) 4095874

Return to Previous Page

New!

Availability: In stock

GLP-2 (1-33) (human) ammonium acetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH ammonium acetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4095874.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 102.00	CHF 94.86 (7%)
4095874.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 179.00	CHF 166.47 (7%)

Add to Wish List

Add to Compare

Catalog Number H-7742

APC Number 46-0-80

One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Synonyms Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human), GLP-2, human

Molecular Formula C₁₆₅H₂₅₄N₄₄O₅₅S

Relative Molecular Mass 3766.16

CAS Registry Number [223460-79-5] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Diabetes

Links / Documents:

Brochures: