×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095855
Return to Previous Page
New!
4095855

Availability: In stock

pTH (1-34) (human) trifluoroacetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH trifluoroacetate salt

4095855

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095855.0500 0.5 mg Ships within 3-5 business days  
CHF 92.00
CHF 85.56 (7%)
4095855.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)

Details

Intermittent administration of teriparatide stimulates bone formation by increasing the number of osteoblasts. Agonist of the parathyroid hormone receptor PTH1.
Catalog Number H-7736
APC Number 22-1-25
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Parathyroid Hormone (1-34), human (Teriparatide), Teriparatide
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number 52232-67-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Osteoporosis Research
Regenerative Medicine
Veterinary Medicine
Links / Documents:

Bachem product citations

R.I.Gafni et al., J. Bone Miner. Res., 27, 1811 (2012)

Product citations

J.E.Compston, Bone, 40, 1447 (2007)
R.L.Jilka, Bone, 40, 1434 (2007)
J.F.Whitfield, Cancer Lett., 244, 8 (2006)
Related products