Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095855
Return to Previous Page
New!
4095855

Availability: In stock

pTH (1-34) (human) trifluoroacetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH trifluoroacetate salt

4095855

Also available as cGMP API.
Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4095855.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 92.00
CHF 85.56 (7%)
4095855.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
Add to Wish List
Add to Compare

Details

Intermittent administration of teriparatide stimulates bone formation by increasing the number of osteoblasts. Agonist of the parathyroid hormone receptor PTH1.
Catalog Number H-7736
APC Number 22-1-25
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Teriparatide, Parathyroid Hormone (1-34), human (Teriparatide)
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number [52232-67-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Osteoporosis Research
Regenerative Medicine
Veterinary Medicine
Links / Documents:
Brochures:
No brochures found.

Bachem product citations

R.I.Gafni et al., J. Bone Miner. Res., 27, 1811 (2012)

Product citations

J.E.Compston, Bone, 40, 1447 (2007)
R.L.Jilka, Bone, 40, 1434 (2007)
J.F.Whitfield, Cancer Lett., 244, 8 (2006)
Related products