×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095736
Return to Previous Page
New!
4095736

Availability: In stock

(Arg¹³)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4095736

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095736.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)
4095736.1000 1 mg Ships within 3-5 business days  
CHF 270.00
CHF 251.10 (7%)

Details

H13R, a mutation in the metal-binding region of Abeta reduces its copper-mediated toxicity. The native rodent sequence containing an arginine at this position is more tolerant to metals than the human amyloid peptide.
Catalog Number H-7662
APC Number 62-0-27
One Letter Code DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms [Arg13] β-Amyloid (1-40)
Molecular Formula C₁₉₄H₃₀₀N₅₄O₅₈S
Relative Molecular Mass 4348.91
CAS Registry Number 1816939-33-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

J.F.Poduslo et al., PLoS One, 5, e8813 (2010)
X.Dai et al., J. Mol. Neurosci., 41, 66 (2010)
D.P.Smith et al., J. Biol. Chem., 281, 15145 (2006)