Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Arg¹³)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4095736

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095736.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)
4095736.1000 1 mg Ships within 3-5 business days  
CHF 270.00
CHF 251.10 (7%)

Details

H13R, a mutation in the metal-binding region of Abeta reduces its copper-mediated toxicity. The native rodent sequence containing an arginine at this position is more tolerant to metals than the human amyloid peptide.
Catalog Number H-7662
APC Number 62-0-27
One Letter Code DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms [Arg13] β-Amyloid (1-40)
Molecular Formula C₁₉₄H₃₀₀N₅₄O₅₈S
Relative Molecular Mass 4348.91
CAS Registry Number 1816939-33-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease