×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4095430
Return to Previous Page
New!
4095430

Availability: In stock

Tau Peptide (306-336) (Repeat 3 Domain) trifluoroacetate salt
H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH trifluoroacetate salt

4095430

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4095430.0500 0.5 mg Ships within 3-5 business days  
CHF 71.00
CHF 66.03 (7%)
4095430.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 122.00
CHF 113.46 (7%)

Details

The amphipathic helical structure of the third fragment (306-336) in the four-repeat microtubule-binding domain of the water-soluble tau protein could be responsible for the formation of the neuropathological filament.
Catalog Number H-7814
One Letter Code VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Molecular Formula C₁₄₃H₂₃₆N₄₂O₄₂S
Relative Molecular Mass 3247.77
CAS Registry Number 330456-26-3
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Tau Peptides
Links / Documents:
Brochures:

Product citations

Q.-F.Ma et al., Biopolymers, 79, 74 (2005)
K.Minoura et al., Biochem. Biophys. Res. Commun., 294, 210 (2002)
B.Trinczek et al., Mol. Biol. Cell, 6, 1887 (1995)
Related products