Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4090154
Return to Previous Page
4090154

Availability: In stock

5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4090154

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4090154.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 237.00
CHF 220.41 (7%)
4090154.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 890.00
CHF 827.70 (7%)

Details

Anderson and Webb could verify using transmission electron microscopy that N-terminal labeling of Aβ40 with TAMRA and other fluorescent dyes does not prevent the formation of protofibrils and amyloid fibrils of various widths.
Catalog Number H-7452
One Letter Code TAMRA- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVV
Synonyms 5-TAMRA-Aβ40
Molecular Formula C₂₁₉H₃₁₅N₅₅O₆₂S
Relative Molecular Mass 4742.31
CAS Registry Number [1802087-81-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

J.Domert et al., Neurobiol. Dis., 65, 82 (2014)
V.L.Anderson and W.W.Webb, BMC Biotechnol., 11, 125 (2011)
A.Belitzky et al., Phys. Chem. Chem. Phys., 13, 13809 (2011)
Related products