×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4090154
Return to Previous Page
4090154

Availability: In stock

5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4090154

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4090154.0100 0.1 mg Ships within 3-5 business days  
CHF 237.00
CHF 220.41 (7%)
4090154.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 890.00
CHF 827.70 (7%)

Details

Anderson and Webb could verify using transmission electron microscopy that N-terminal labeling of Aβ40 with TAMRA and other fluorescent dyes does not prevent the formation of protofibrils and amyloid fibrils of various widths.
Catalog Number H-7452
One Letter Code TAMRA- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVV
Synonyms 5-TAMRA-Aβ40
Molecular Formula C₂₁₉H₃₁₅N₅₅O₆₂S
Relative Molecular Mass 4742.31
CAS Registry Number 1802087-81-5
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

J.Domert et al., Neurobiol. Dis., 65, 82 (2014)
A.Belitzky et al., Phys. Chem. Chem. Phys., 13, 13809 (2011)
Related products