Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4090147
Return to Previous Page
4090147

Availability: In stock

Amyloid β-Protein (1-40) (HFIP-treated)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (HFIP-treated)

4090147

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4090147.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 112.00
CHF 104.16 (7%)
4090147.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 301.00
CHF 279.93 (7%)
4090147.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 561.00
CHF 521.73 (7%)

Details

H-7438 was obtained by dissolving Amyloid β-Protein (1-40) (H-1194) in HFIP, aliquoting, and removing the solvent as described in the literature. The morphology of the resulting peptide was studied by transmission electron microscopy (TEM). The magenta arrow points to the nucleation centers where aggregation starts. The yellow arrow indicates the fibrils which are formed as long thin helical structures with regular twists.
Catalog Number H-7438
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 (HFIP-treated)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [131438-79-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:
Related products