×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4089807
Return to Previous Page
4089807

Availability: In stock

(Cys²⁶)-Amyloid β-Protein (1-40) (Dimer) trifluoroacetate salt
(H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH)₂ trifluoroacetate salt (Disulfide bond)

4089807

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4089807.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4089807.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)

Details

Dimer of (Cys²⁶)-Aβ40.
Catalog Number H-7418
One Letter Code (DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV)₂
Synonyms Amyloid β-Protein (1-40) S26C (Dimer)
Molecular Formula C₃₈₈H₅₈₈N₁₀₆O₁₁₄S₄
Relative Molecular Mass 8689.85
CAS Registry Number 1802087-75-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

N.W.Hu et al., Brain, 131, 2414 (2008)