×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4088071
Return to Previous Page
New!
4088071

Availability: In stock

Tau Peptide (255-314) (Repeat 2 Domain) (human) trifluoroacetate salt
H-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-Val-Gln-Ile-Ile-Asn-Lys-Lys-Leu-Asp-Leu-Ser-Asn-Val-Gln-Ser-Lys-Cys-Gly-Ser-Lys-Asp-Asn-Ile-Lys-His-Val-Pro-Gly-Gly-Gly-Ser-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-OH trifluoroacetate salt

4088071

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4088071.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 597.00
CHF 555.21 (7%)
4088071.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,015.00
CHF 943.95 (7%)
Catalog Number H-8038
One Letter Code NVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVD
Molecular Formula C₂₇₇H₄₆₇N₈₃O₈₆S
Relative Molecular Mass 6368.33
CAS Registry Number 2022995-68-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Tau Peptides
Links / Documents:
Brochures: