Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4079936
Return to Previous Page
4079936

Availability: In stock

Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt

4079936

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4079936.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)
4079936.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 277.00
CHF 257.61 (7%)

Details

Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.
Catalog Number H-7348
One Letter Code YDEYLKQVIEVLETDPHFREKLQKADIEEI
Molecular Formula C₁₆₇H₂₆₀N₄₀O₅₄
Relative Molecular Mass 3692.14
CAS Registry Number 1872441-22-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Application Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:

Product citations

A.Stengel et al., Peptides, 35, 143 (2012)
M.Goebel et al., Peptides, 32, 36 (2011)
I.S.Oh et al., Nature, 443, 709 (2006)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)