Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4079936
Return to Previous Page
4079936

Availability: In stock

Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt

4079936

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4079936.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)
4079936.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 277.00
CHF 257.61 (7%)
Add to Wish List
Add to Compare

Details

Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment (H-7346).
Catalog Number H-7348
One Letter Code YDEYLKQVIEVLETDPHFREKLQKADIEEI
Molecular Formula C₁₆₇H₂₆₀N₄₀O₅₄
Relative Molecular Mass 3692.14
CAS Registry Number [1872441-22-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Areas of Interest Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:
Brochures:
No brochures found.

Product citations

A.Stengel et al., Peptides, 35, 143 (2012)
M.Goebel et al., Peptides, 32, 36 (2011)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)
I.S.Oh et al., Nature, 443, 709 (2006)