×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4079936
Return to Previous Page
4079936

Availability: In stock

Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt

4079936

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4079936.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)

Details

Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.
Catalog Number H-7348
One Letter Code YDEYLKQVIEVLETDPHFREKLQKADIEEI
Molecular Formula C₁₆₇H₂₆₀N₄₀O₅₄
Relative Molecular Mass 3692.14
CAS Registry Number 1872441-22-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Application Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:

Product citations

A.Stengel et al., Peptides, 35, 143 (2012)
M.Goebel et al., Peptides, 32, 36 (2011)
I.S.Oh et al., Nature, 443, 709 (2006)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)