Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4079935
Return to Previous Page
4079935

Availability: In stock

Nesfatin-1 (30-59) (human) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt

4079935

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4079935.0500 0.5 mg Ships within 3-5 business days  
CHF 163.00
CHF 151.59 (7%)
4079935.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 277.00
CHF 257.61 (7%)

Details

Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.
Catalog Number H-7346
One Letter Code YDEYLKQVIDVLETDKHFREKLQKADIEEI
Molecular Formula C₁₆₇H₂₆₃N₄₁O₅₄
Relative Molecular Mass 3709.17
CAS Registry Number [1872441-21-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Areas of Interest Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:
Brochures:
No brochures found.

Product citations

A.Stengel et al., Peptides, 35, 143 (2012)
M.Goebel et al., Peptides, 32, 36 (2011)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)
I.S.Oh et al., Nature, 443, 709 (2006)