×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4079935
Return to Previous Page
4079935

Availability: In stock

Nesfatin-1 (30-59) (human) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt

4079935

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4079935.0500 0.5 mg Ships within 3-5 business days  
CHF 163.00
CHF 151.59 (7%)

Details

Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.
Catalog Number H-7346
One Letter Code YDEYLKQVIDVLETDKHFREKLQKADIEEI
Molecular Formula C₁₆₇H₂₆₃N₄₁O₅₄
Relative Molecular Mass 3709.17
CAS Registry Number 1872441-21-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Application Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:

Product citations

A.Stengel et al., Peptides, 35, 143 (2012)
M.Goebel et al., Peptides, 32, 36 (2011)
I.S.Oh et al., Nature, 443, 709 (2006)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)