Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Nesfatin-1 (30-59) (human) trifluoroacetate salt
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt


Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4079935.0500 0.5 mg Ships within 3-5 business days  
CHF 163.00
CHF 151.59 (7%)
4079935.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 277.00
CHF 257.61 (7%)
Add to Wish List
Add to Compare


Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.
Catalog Number H-7346
Molecular Formula C₁₆₇H₂₆₃N₄₁O₅₄
Relative Molecular Mass 3709.17
CAS Registry Number [1872441-21-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide