M65 4067721 | Bachem

Return to Previous Page

Availability: In stock

M65 trifluoroacetate salt
H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4067721.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 357.00	CHF 332.01 (7%)
4067721.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 663.00	CHF 616.59 (7%)

Add to Wish List

Add to Compare

Potent and specific PAC1 receptor antagonist.

Catalog Number H-6736

One Letter Code CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂

Synonyms PAC1 Receptor Antagonist M65, (Des-Lys³⁸)-PAC1 Receptor Antagonist M65

Molecular Formula C₂₀₅H₃₂₆N₆₄O₆₁S₅

Relative Molecular Mass 4823.57

CAS Registry Number [1872440-65-7] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Links / Documents:

Brochures: