×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4067721
Return to Previous Page
4067721

Availability: In stock

M65 trifluoroacetate salt
H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)

4067721

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4067721.0500 0.5 mg Ships within 3-5 business days  
CHF 357.00
CHF 332.01 (7%)
4067721.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 663.00
CHF 616.59 (7%)

Details

Potent and specific PAC1 receptor antagonist.
Catalog Number H-6736
One Letter Code CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂
Synonyms PAC1 Receptor Antagonist M65
Molecular Formula C₂₀₅H₃₂₆N₆₄O₆₁S₅
Relative Molecular Mass 4823.57
CAS Registry Number 1872440-65-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures:

Bachem product citations

Z.Pirger et al., J. Gerontol. A Biol. Sci. Med. Sci., 69, 1331 (2014)

Product citations

E.A.Lerner et al., Peptides, 28, 1651 (2007)
O.Moro et al., J. Biol. Chem., 274, 23103 (1999)