Amyloid β-Protein (1-42) (scrambled) 4064853

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
H-Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4064853.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 356.00	CHF 331.08 (7%)
4064853.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 485.00	CHF 451.05 (7%)

Add to Wish List

Add to Compare

Inactive control for H-1368, H-6466, H-8146

Catalog Number H-7406

APC Number 62-0-46

One Letter Code AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

Synonyms β-Amyloid (1-42) Scrambled

Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S

Relative Molecular Mass 4514.10

CAS Registry Number [1678415-52-5] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Alzheimer's Disease

Links / Documents:

Brochures: