(Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) 4063516 | Bachem https://shop.bachem.com/4063516.html

Return to Previous Page

Availability: In stock

(Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) trifluoroacetate salt
H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt (Disulfide bond)

4063516

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price
4063516.0100	0.1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 97.00	CHF 90.21 (7%)
4063516.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 367.00	CHF 341.31 (7%)
4063516.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 617.00	CHF 573.81 (7%)

Details

The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals.

Catalog Number H-7534

One Letter Code YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Synonyms Osteocalcin (1-49) (human) (decarboxylated)

Molecular Formula C₂₆₆H₃₈₁N₆₇O₇₆S₂

Relative Molecular Mass 5797.49

CAS Registry Number 1927927-11-4

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Bone hormone involved in glucose metabolism

Application Diabetes
Obesity Research

Links / Documents: