Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4062220
Return to Previous Page

Promobanner OCT 2020

4062220

Availability: In stock

Adrenomedullin 5 (primate) trifluoroacetate salt
H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

4062220

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4062220.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 630.00
CHF 585.90 (7%)

Details

Adrenomedullin 5 (AM5) stimulates central and peripheral cardiovascular actions in mammals. The peptide induced dose-dependent decreases in arterial pressure without affecting the heart rate, when injected intravenously. When injected into the cerebral ventricle, ADM5 increased arterial pressure and heart rate.
Catalog Number H-6612
One Letter Code HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂
Synonyms AM5 (primate)
Molecular Formula C₂₅₃H₃₉₄N₈₂O₇₁S₂
Relative Molecular Mass 5784.55
CAS Registry Number 1816939-48-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Application Cardiovascular System & Diseases
Links / Documents:

Product citations

Y.Takei et al., J. Endocrinol., 197, 391 (2008)