×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4062220
Return to Previous Page
4062220

Availability: Out of stock

Adrenomedullin 5 (primate) trifluoroacetate salt
H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

4062220

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price
4062220.0500 0.5 mg Request lead time  
CHF 630.00
CHF 585.90 (7%)

Details

Adrenomedullin 5 (AM5) stimulates central and peripheral cardiovascular actions in mammals. The peptide induced dose-dependent decreases in arterial pressure without affecting the heart rate, when injected intravenously. When injected into the cerebral ventricle, ADM5 increased arterial pressure and heart rate.
Catalog Number H-6612
One Letter Code HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂
Synonyms AM5 (primate)
Molecular Formula C₂₅₃H₃₉₄N₈₂O₇₁S₂
Relative Molecular Mass 5784.55
CAS Registry Number 1816939-48-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Application Cardiovascular System & Diseases
Links / Documents:

Product citations

Y.Takei et al., J. Endocrinol., 197, 391 (2008)