×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4062195
Return to Previous Page
4062195

Availability: In stock

Amyloid β-Protein (1-37) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-OH trifluoroacetate salt

4062195

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4062195.0500 0.5 mg Ships within 3-5 business days  
CHF 230.00
CHF 213.90 (7%)
4062195.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 398.00
CHF 370.14 (7%)
Catalog Number H-7462
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Formula C₁₈₂H₂₇₄N₅₀O₅₅S
Relative Molecular Mass 4074.55
CAS Registry Number 186359-67-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

B.D.Moore et al., Alzheimer Res. Ther., 4, 18 (2012)
H.Schieb et al., J. Biol. Chem., 286, 33747 (2011)
M.Bibl et al., Brain, 129, 1177 (2006)
J.Wiltfang et al., J. Neurochem., 81, 481 (2002)